Buy peptides online,[Des-His1,Glu9] Glucagon, Amide

.
[Des-His1,Glu9] Glucagon, amide buy peptides online

Name: [Des-His1,Glu9] Glucagon, amide
The alias:
Sequence of single letter abbreviation:SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2
A basic description:
solubility:
The molecular weight: 3358.7
Chemical formula: C148H221N41O47S1
The purity: > 95%
Storage conditions: Store at -20℃. Keep tightly closed. Store in a cool dry place.
Annotation:
Reference:C.G. Unson et al., Peptides, 10, 1171 (1989)
The C-terminal:
The N-terminal:
Chemical bridge:

Get quotation of [Des-His1,Glu9] Glucagon, amide now buy peptides online

Total Custom Peptides List buy peptides online

entries per page

Search:

Item	sum_table_productname	Weight	The purity	View more
1	Adrenomedullin (1-52) human	1mg/5mg/10mg	>95%	View more
2	alpha Defensin 2 (human)	1mg/5mg/10mg	>95%	View more
3	(Ac-LEHD-AFC )	1mg/5mg/10mg	>95%	View more
4	(Ac-Nle4, Asp5, DPhe7, Lys10)-Cyclo-a-MSH (4-10) amide, MTII	1mg/5mg/10mg	>95%	View more
5	(Ala96)-Myelin Basic Protein (87-99) (human, bovine, rat)	1mg/5mg/10mg	>95%	View more
6	(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)	1mg/5mg/10mg	>95%	View more
7	(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676)	1mg/5mg/10mg	>95%	View more
8	(Cys(Bzl)84,Glu(OBzl)85)-CD4 (81-92)	1mg/5mg/10mg	>95%
9	(Cys39)-Tissue Factor (33-53)	1mg/5mg/10mg	>95%	View more
10	(Des-octanoyl)-Ghrelin, human	1mg/5mg/10mg	>95%	View more

Showing 1 to 10 of 2,412 entries

Note: As the total list is pretty long with 2000+ records, please use the search function to get what you need quickly. For the quotation, please sending us a message on the sidebar or email us at:sales@AminoPrimeCentral.com, we will get back to you ASAP (within 2-8 hours)

buy peptides online

. [Des-His1,Glu9] Glucagon, amide buy peptides online

Get quotation of [Des-His1,Glu9] Glucagon, amide now buy peptides online

Total Custom Peptides List buy peptides online

.
[Des-His1,Glu9] Glucagon, amide buy peptides online